Structure of PDB 8oo0 Chain LO

Receptor sequence

>8oo0LO (length=203) Species: 209285 (Thermochaetoides thermophila) [Search protein sequence]

SSFESVVVIDGKGHLLGRLASIVAKQLLSGQKIVVVRCEALNISGEFFRA
KLKYHAYLRKMTRYNPTRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAAL
ERLKVFEGVPPPYDKKKKMVVPQALRVLRLQPGRKYCTVGRLSHEVGWKY
QDVVARLEERRKAKGAAYYERKKLAARQLSEAKKAAAAKVDPKVSEALAA
YGY

3D structure

PDB

8oo0 Methionine aminopeptidase 2 and its autoproteolysis product have different binding sites on the ribosome.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LO	S6 K13 G18 R19 S22 F49 R50 K61 R64 N66 R69 G70 G71 P72 H74 R76 A85 R87 M89 R96 R103 V110 P112 K116 K117 R130 L131 Q132 R135 K136 K150 Y151 K163 Y169 Y170 K173 R178	S5 K12 G17 R18 S21 F48 R49 K60 R63 N65 R68 G69 G70 P71 H73 R75 A84 R86 M88 R95 R102 V109 P111 K115 K116 R129 L130 Q131 R134 K135 K149 Y150 K162 Y168 Y169 K172 R177

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0017148	negative regulation of translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8oo0, PDBe:8oo0, PDBj:8oo0
PDBsum	8oo0
PubMed	38267453
UniProt	G0SH61

[Back to BioLiP]