Structure of PDB 8rxx Chain LN

Receptor sequence

>8rxxLN (length=199) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]

ARRPSRCYRFCKNKPYPKSRFCRGVPDPKIRNFDIGRRRATVDEFPVCIH
VVSRELEQIASEALEAARIQANKYMVKRANKDVFHMRTRAHPFHVLRINK
GMRGAFGKPNGVCARVRIGQILLSMRTKEAYVPQAFEALRRAKMKFPGRQ
IIVMSKYWGFTNILRTEYEALRDAGKLEQRGTHCKLIAPKGKITMRNVM

3D structure

PDB

8rxx Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.

Chain

Resolution

2.97 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	LN	R4 K13 N14 K15 Y17 R21 F22 D35 R39 R40 R90 H92 F94 R98 N100 G114 A118 F119 R130 R193 G194 T195 H196	R3 K12 N13 K14 Y16 R20 F21 D34 R38 R39 R89 H91 F93 R97 N99 G101 A105 F106 R117 R180 G181 T182 H183
BS02	rna	LN	R4 P5 S6 R7 R10 K15 E63 A64 Q71 K74 G114 M115 R116 F119 R154 M157 K158 P160	R3 P4 S5 R6 R9 K14 E62 A63 Q70 K73 G101 M102 R103 F106 R141 M144 K145 P147
BS03	rna	LN	E56 L57 I131 P202 K203 G204 K205 I206 N210	E55 L56 I118 P189 K190 G191 K192 I193 N197

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8rxx, PDBe:8rxx, PDBj:8rxx
PDBsum	8rxx
PubMed	38722744
UniProt	O97213

[Back to BioLiP]