Structure of PDB 8pv7 Chain LN

Receptor sequence

>8pv7LN (length=202) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

GALKYLEELSKKKQSDVVRFLLRVRCWEYRQLNVIHRASRPSRPDKARRL
GYKAKQGYVIYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLRAT
AEERVGRRCSNLRVLNSYWVNQDSTYKYYEVILVDPNHKAIRRDPRINWI
CNPVHKHRECRGLTSTGKKSRGLNKGHRFNKTRAGRRKTWKRHNTLSLWR
YR

3D structure

PDB

8pv7 Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.

Chain

Resolution

2.12 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LN	G2 K5 K12 K14 Q15 R24 R31 N34 V35 S40 R41 R44 K47 R49 R50 L51 K54 A55 K56 Q57 R67 R68 G69 G70 R71 K72 R73 P74 P76 K77 A79 Y81 G82 K83 P84 N86 Q87 Q91 K93 Y94 Q95 R96 S97 L98 R105 R108 N112 N117 W120 S125 Y127 K128 N138 K140 R144 R147 W150 P154 H156 K157 H158 C161 R162 L164 S166 K170 S171 R172 L174 K176 G177 H178 R179 F180 N181 K182 R187 R188 K189 W191 K192 R193 H194 S198 W200 R201 Y202 R203	G1 K4 K11 K13 Q14 R23 R30 N33 V34 S39 R40 R43 K46 R48 R49 L50 K53 A54 K55 Q56 R66 R67 G68 G69 R70 K71 R72 P73 P75 K76 A78 Y80 G81 K82 P83 N85 Q86 Q90 K92 Y93 Q94 R95 S96 L97 R104 R107 N111 N116 W119 S124 Y126 K127 N137 K139 R143 R146 W149 P153 H155 K156 H157 C160 R161 L163 S165 K169 S170 R171 L173 K175 G176 H177 R178 F179 N180 K181 R186 R187 K188 W190 K191 R192 H193 S197 W199 R200 Y201 R202
BS02	rna	LN	R38 Q57 V60 Y62 R109 C110 N112 D136 H139	R37 Q56 V59 Y61 R108 C109 N111 D135 H138

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8pv7, PDBe:8pv7, PDBj:8pv7
PDBsum	8pv7
PubMed	37921038
UniProt	G0RZ88

[Back to BioLiP]