Structure of PDB 8pfr Chain LN

Receptor sequence

>8pfrLN (length=204) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

ARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVH
LVSNELEQLSSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRINK
MGMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVEGLRRARYKFPGQ
QKIILSKKWGFTNLDRPEYLKKREAGEVKDDGAFVKFLSKKGSLENNIRE
FPEY

3D structure

PDB

8pfr Real-space refinement in PHENIX for cryo-EM and crystallography.

Chain

Resolution

2.15 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	LN	R3 R4 A6 R7 K13 N14 K15 P16 Y17 R21 Y22 K39 K40 E63 A64 A67 K74 R88 R90 H92 F94 R98 N100 M102 G114 M115 R116 W119 Y157 K158 P160 D193 G194 F196 K198	R2 R3 A5 R6 K12 N13 K14 P15 Y16 R20 Y21 K38 K39 E62 A63 A66 K73 R87 R89 H91 F93 R97 N99 M101 G102 M103 R104 W107 Y145 K146 P148 D181 G182 F184 K186
BS02	rna	LN	Y11 E56 L57 I131 K202 K203 G204 L206	Y10 E55 L56 I119 K190 K191 G192 L194
BS03	MG	LN	R7 R10	R6 R9
BS04	MG	LN	R98 I99 G120	R97 I98 G108

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006415	translational termination

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8pfr, PDBe:8pfr, PDBj:8pfr
PDBsum	8pfr
PubMed
UniProt	P41805\|RL10_YEAST Large ribosomal subunit protein uL16 (Gene Name=RPL10)

[Back to BioLiP]