Structure of PDB 8p8m Chain LN

Receptor sequence

>8p8mLN (length=206) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

ARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVH
LVSNELEQLSSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRINK
MQQGMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVEGLRRARYKFP
GQQKIILSKKWGFTNLDRPEYLKKREAGEVKDDGAFVKFLSKKGSLENNI
REFPEY

3D structure

PDB

8p8m Yeast 60S ribosomal subunit, RPL39 deletion

Chain

Resolution

2.66 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LN	R3 R4 A6 R7 K13 N14 K15 P16 Y22 R24 Y34 D35 K39 E63 A67 K74 R88 R90 H92 F94 R98 N100 M115 R116 W119 Y157 K158 P160 D193 G194 K198	R2 R3 A5 R6 K12 N13 K14 P15 Y21 R23 Y33 D34 K38 E62 A66 K73 R87 R89 H91 F93 R97 N99 M105 R106 W109 Y147 K148 P150 D183 G184 K188
BS02	rna	LN	E56 L57 K202 K203 G204 L206	E55 L56 K192 K193 G194 L196

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006415	translational termination

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8p8m, PDBe:8p8m, PDBj:8p8m
PDBsum	8p8m
PubMed
UniProt	P41805\|RL10_YEAST Large ribosomal subunit protein uL16 (Gene Name=RPL10)

[Back to BioLiP]