Structure of PDB 8k82 Chain LN

Receptor sequence

>8k82LN (length=203) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

GAYKYLEELQRKKQSDVLRFLQRVRVWEYRQKNVIHRAARPTRPDKARRL
GYKAKQGFVIYRVRVRRGNRKRPVPKGATYGKPTNQGVNELKYQRSLRAT
AEERVGRRAANLRVLNSYWVNQDSTYKYFEVILVDPQHKAIRRDARYNWI
CDPVHKHREARGLTATGKKSRGINKGHKFNNTKAGRRKTWKRQNTLSLWR
YRK

3D structure

PDB

8k82 Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	LN	G2 Y4 K5 E8 R12 K13 K14 Q15 R20 R24 W28 R31 N34 V35 R41 R44 K47 R49 R50 L51 K54 A55 K56 Q57 R67 R68 G69 N70 R71 K72 R73 P76 Y81 G82 K83 P84 T85 N86 Q87 N90 E91 K93 Y94 Q95 R96 E104 R108 N112 W120 S125 Y127 K128 Q138 H139 K140 R144 R147 W150 H156 K157 H158 R162 L164 A166 K169 K170 S171 R172 I174 K176 G177 H178 K179 F180 N181 R187 R188 K189 W191 K192 R193 Q194 W200 R201 Y202 R203 K204	G1 Y3 K4 E7 R11 K12 K13 Q14 R19 R23 W27 R30 N33 V34 R40 R43 K46 R48 R49 L50 K53 A54 K55 Q56 R66 R67 G68 N69 R70 K71 R72 P75 Y80 G81 K82 P83 T84 N85 Q86 N89 E90 K92 Y93 Q94 R95 E103 R107 N111 W119 S124 Y126 K127 Q137 H138 K139 R143 R146 W149 H155 K156 H157 R161 L163 A165 K168 K169 S170 R171 I173 K175 G176 H177 K178 F179 N180 R186 R187 K188 W190 K191 R192 Q193 W199 R200 Y201 R202 K203
BS02	rna	LN	R38 Q57 Y62 R109 N112 L113 D136 H139	R37 Q56 Y61 R108 N111 L112 D135 H138
BS03	MG	LN	T80 Y81	T79 Y80

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8k82, PDBe:8k82, PDBj:8k82
PDBsum	8k82
PubMed	38942792
UniProt	P05748\|RL15A_YEAST Large ribosomal subunit protein eL15A (Gene Name=RPL15A)

[Back to BioLiP]