Structure of PDB 8i9p Chain LN

Receptor sequence

>8i9pLN (length=183) Species: 759272 (Thermochaetoides thermophila DSM 1495)

GALKYLEELSKKKQSDVVRFLLRVRCWEYRQLNVIHRASRPSRPDKARRL
GYKAKQGYVIYRVRVRRGGRQLKYQRSLRATAEERVGRRCSNLRVLNSYW
VNQDSTYKYYEVILVDPNHKAIRRDPRINWICNPVHKHRECRGLTSTGKK
SRGLNKGHRFNKTRAGRRKTWKRHNTLSLWRYR

3D structure

• PDB: 8i9p Mechanism of 5S RNP recruitment and helicase-surveilled rRNA maturation during pre-60S biogenesis.
• Chain: LN
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LN	G2 K5 E8 K12 K14 Q15 S40 R41 R44 K47 R49 R50 L51 K54 A55 K56 Q57 R68 G69 Q91 K93 Y94 Q95 R96 S97 L98 N112 N117 W120 Q123 N138 K140 R144 R147 W150 P154 V155 H156 K157 H158 C161 R162 L164 S166 K170 S171 R172 L174 K176 G177 H178 R179 F180 N181 K182 R187 R188 K189 W191 K192 R193 H194 W200 R201 Y202 R203	G1 K4 E7 K11 K13 Q14 S39 R40 R43 K46 R48 R49 L50 K53 A54 K55 Q56 R67 G68 Q71 K73 Y74 Q75 R76 S77 L78 N92 N97 W100 Q103 N118 K120 R124 R127 W130 P134 V135 H136 K137 H138 C141 R142 L144 S146 K150 S151 R152 L154 K156 G157 H158 R159 F160 N161 K162 R167 R168 K169 W171 K172 R173 H174 W180 R181 Y182 R183
BS02	rna	LN	R38 Q57 Y62 R109 N112 D136 H139	R37 Q56 Y61 R89 N92 D116 H119

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8i9p, PDBe:8i9p, PDBj:8i9p
• PDBsum: 8i9p
• PubMed: 37129998
• UniProt: G0RZ88