Structure of PDB 7zw0 Chain LN

Receptor sequence

>7zw0LN (length=172) Species: 580240 (Saccharomyces cerevisiae W303) [Search protein sequence]

AKAQNPMRDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQTPVQSKARY
TVRTFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYQLRDRNFSATGNF
GFGIDEHIDLGIKYDPSIGIFGMDFYVVMNRPGARVTRRKRCKGTVGNSH
KTTKEDTVSWFKQKYDADVLDK

3D structure

PDB

7zw0 Sensing of individual stalled 80S ribosomes by Fap1 for nonfunctional rRNA turnover.

Chain

Resolution

2.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LN	K16 V18 N20 S22 S48 A50 R51 Y52 T56 F57 I59 I65 A66 H68 R92 R94 N95 S97 A98 T99 N101 G103 F104 G105 D107 G124 Y128 K142	K14 V16 N18 S20 S46 A48 R49 Y50 T54 F55 I57 I63 A64 H66 R90 R92 N93 S95 A96 T97 N99 G101 F102 G103 D105 G122 Y126 K140
BS02	rna	LN	A3 N7 M9 Q43 T44 V46 T70 R72 G135 R137 V138 R141 R143 G149 N150 H152	A1 N5 M7 Q41 T42 V44 T68 R70 G133 R135 V136 R139 R141 G147 N148 H150

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7zw0, PDBe:7zw0, PDBj:7zw0
PDBsum	7zw0
PubMed	36113412
UniProt	P0C0W9\|RL11A_YEAST Large ribosomal subunit protein uL5A (Gene Name=RPL11A)

[Back to BioLiP]