Structure of PDB 7y5e Chain LN

Receptor sequence
>7y5eLN (length=140) Species: 35688 (Porphyridium purpureum) [Search protein sequence]
DFISPYNEDPFVGNLSTPINTSSFTKGLLSNLPAYRRGLSPLLRGLEIGM
AHGYFLIGPFYKLGPLRSTDVALLSGFLSTVGLILILTTCLSIYGSVSFD
KEDTKDSLQTSEGWGQFTAGFLVGAVGGSGFAYLLLANLP
3D structure
PDB7y5e In situ structure of the red algal phycobilisome-PSII-PSI-LHC megacomplex.
ChainLN
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA LN P61 F62 L65 G66 P67 P59 F60 L63 G64 P65
BS02 CLA LN L58 L89 L56 L87
BS03 CLA LN P67 L80 S81 G84 I88 P65 L78 S79 G82 I86
BS04 CLA LN N33 L34 R38 E49 N31 L32 R36 E47
BS05 CLA LN P35 A36 I50 P33 A34 I48
BS06 CLA LN Y56 F57 G60 P61 L138 Y54 F55 G58 P59 L136
BS07 CLA LN N16 T19 I21 N22 L31 N14 T17 I19 N20 L29
BS08 ZEX LN L76 V125 L74 V123
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009538 photosystem I reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7y5e, PDBe:7y5e, PDBj:7y5e
PDBsum7y5e
PubMed36922595
UniProtW0S1Z0

[Back to BioLiP]