Structure of PDB 8qoi Chain LM

Receptor sequence

>8qoiLM (length=139) Species: 9606 (Homo sapiens) [Search protein sequence]

VFRRFVEVGRVAYVSFGPHAGKLVAIVDVIDQNRALVDGPCTQVRRQAMP
FKCMQLTDFILKFPHSAHQKYVRQAWQKADINTKWAATRWAKKIEARERK
AKMTDFDRFKVMKAKKMRNRIIKNEVKKLQKAALLKASP

3D structure

PDB

8qoi The structure of the human 80S ribosome at 1.9 A resolution reveals the molecular role of chemical modifications and ions in RNA

Chain

Resolution

1.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LM	V2 R4 R5 F17 P19 H20 D29 N34 Q44 V45 R46 Q48 Q56 P65 H66 H69 Q70 K71 Y72 R74 R90 W91 K94 R98 K101 M113 K114 K116 K117 M118 N120 R121 K124 K129 K132	V1 R3 R4 F16 P18 H19 D28 N33 Q43 V44 R45 Q47 Q55 P64 H65 H68 Q69 K70 Y71 R73 R89 W90 K93 R97 K100 M112 K113 K115 K116 M117 N119 R120 K123 K128 K131

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0045296	cadherin binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006364	rRNA processing
GO:0006412	translation
GO:0042273	ribosomal large subunit biogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0014069	postsynaptic density
GO:0016020	membrane
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:0045202	synapse
GO:0070062	extracellular exosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8qoi, PDBe:8qoi, PDBj:8qoi
PDBsum	8qoi
PubMed	38844527
UniProt	P50914\|RL14_HUMAN Large ribosomal subunit protein eL14 (Gene Name=RPL14)