Structure of PDB 8k82 Chain LM

Receptor sequence
>8k82LM (length=137) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
STDSIVKASNWRLVEVGRVVLIKKGQSAGKLAAIVEIIDQKKVLIDGPKA
GVPRQAINLGQVVLTPLTFALPRGARTATVSKKWAAAAVCEKWAASSWAK
KIAQRERRAALTDFERFQVMVLRKQKRYTVKKALAKA
3D structure
PDB8k82 Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
ChainLM
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna LM I6 K8 W12 R13 K42 P73 R74 R77 T78 T80 K83 K84 W99 R106 R109 M121 R124 K125 Q126 R128 Y129 K133 A136 I5 K7 W11 R12 K41 P72 R73 R76 T77 T79 K82 K83 W98 R105 R108 M120 R123 K124 Q125 R127 Y128 K132 A135
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0000470 maturation of LSU-rRNA
GO:0002181 cytoplasmic translation
GO:0016236 macroautophagy
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0032991 protein-containing complex
GO:0043232 intracellular non-membrane-bounded organelle
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8k82, PDBe:8k82, PDBj:8k82
PDBsum8k82
PubMed38942792
UniProtP36105|RL14A_YEAST Large ribosomal subunit protein eL14A (Gene Name=RPL14A)

[Back to BioLiP]