Structure of PDB 8flf Chain LM

Receptor sequence

>8flfLM (length=88) Species: 9606 (Homo sapiens)

HTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKK
MQANNAKAMSVSRKLDRLAYIAHPKLGKRARARIAKGL

3D structure

• PDB: 8flf Principles of human pre-60S biogenesis
• Chain: LM
• Resolution: 2.65 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LM	H7 T8 H10 Q12 S13 H17 R18 R25 Q27 R28 Y29 S31 L32 K33 D36 K38 F39 N42 R44 F45 A46 K47 K48 H49 N50 K52 M57 N60 S90 R91 R95 R107 A108 R111 G115	H1 T2 H4 Q6 S7 H11 R12 R19 Q21 R22 Y23 S25 L26 K27 D30 K32 F33 N36 R38 F39 A40 K41 K42 H43 N44 K46 M51 N54 S62 R63 R67 R79 A80 R83 G87
BS02	MG	LM	T9 H10	T3 H4

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0008201 heparin binding
• GO:0045296 cadherin binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0007566 embryo implantation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0016020 membrane
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8flf, PDBe:8flf, PDBj:8flf
• PDBsum: 8flf
• PubMed: 37410842
• UniProt: P47914|RL29_HUMAN Large ribosomal subunit protein eL29 (Gene Name=RPL29)