Structure of PDB 7zw0 Chain LM

Receptor sequence

>7zw0LM (length=211) Species: 580240 (Saccharomyces cerevisiae W303) [Search protein sequence]

ARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVH
LVSNELEQLSSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRINK
MLLQQGMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVEGLRRARYK
FPGQQKIILSKKWGFTNLDRPEYLKKREAGEVKDDGAFVKFLSKKGSLEN
NIREFPEYFAA

3D structure

PDB

7zw0 Sensing of individual stalled 80S ribosomes by Fap1 for nonfunctional rRNA turnover.

Chain

Resolution

2.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LM	R3 R4 A6 R7 K13 N14 K15 Y22 R24 Y34 D35 K39 K40 E63 A64 A67 R90 H92 F94 R98 Q112 G114 M115 R116 W119 R154 Y157 K158 P160 D193 G194 A195 F196 K198	R2 R3 A5 R6 K12 N13 K14 Y21 R23 Y33 D34 K38 K39 E62 A63 A66 R89 H91 F93 R97 Q104 G106 M107 R108 W111 R146 Y149 K150 P152 D185 G186 A187 F188 K190
BS02	rna	LM	Y11 E56 K202 K203 G204 L206 N209 F217	Y10 E55 K194 K195 G196 L198 N201 F209

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0006415	translational termination

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7zw0, PDBe:7zw0, PDBj:7zw0
PDBsum	7zw0
PubMed	36113412
UniProt	P41805\|RL10_YEAST Large ribosomal subunit protein uL16 (Gene Name=RPL10)

[Back to BioLiP]