Structure of PDB 7nrc Chain LM

Receptor sequence

>7nrcLM (length=169) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

QNPMRDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQTPVQSKARYTVR
TFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYQLRDRNFSATGNFGFG
IDEHIDLGIKYDPSIGIFGMDFYVVMNRPGARVTRRKRCKGTVGNSHKTT
KEDTVSWFKQKYDADVLDK

3D structure

PDB

7nrc Structure of Gcn1 bound to stalled and colliding 80S ribosomes.

Chain

Resolution

3.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	LM	T53 R55 R61	T48 R50 R56
BS02	rna	LM	N20 S22 G24 S48 R51 Y52 F57 A66 R94 N95 S97 A98 G103 F104 G105 D107 G124 M125 Y128 R140 K142	N15 S17 G19 S43 R46 Y47 F52 A61 R89 N90 S92 A93 G98 F99 G100 D102 G119 M120 Y123 R135 K137
BS03	rna	LM	M9 Q43 T44 V46 T70 R72 P134 R137 V138 R141 R143 V148 G149 N150 H152	M4 Q38 T39 V41 T65 R67 P129 R132 V133 R136 R138 V143 G144 N145 H147

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7nrc, PDBe:7nrc, PDBj:7nrc
PDBsum	7nrc
PubMed	33790014
UniProt	Q3E757\|RL11B_YEAST Large ribosomal subunit protein uL5B (Gene Name=RPL11B)

[Back to BioLiP]