Structure of PDB 5tcu Chain LM

Receptor sequence

>5tcuLM (length=145) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325)

MRQTFMANESNIERKWYVIDAEGQTLGRLSSEVASILRGKNKVTYTPHVD
TGDYVIVINASKIEFTGNKETDKVYYRHSNHPGGIKSITAGELRRTNPER
LIENSIKGMLPSTRLGEKQGKKLFVYGGAEHPHAAQQPENYELRG

3D structure

• PDB: 5tcu Structural Basis for Linezolid Binding Site Rearrangement in the Staphylococcus aureus Ribosome.
• Chain: LM
• Resolution: 3.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LM	M1 R2 T4 N8 T25 R28 S31 R38 K40 H48 T66 K69 K73 Y76 R77 H78 S79 G83 K86 I88 R100 S105 G108 M109 P111 R114 L115 K121 H133 A135	M1 R2 T4 N8 T25 R28 S31 R38 K40 H48 T66 K69 K73 Y76 R77 H78 S79 G83 K86 I88 R100 S105 G108 M109 P111 R114 L115 K121 H133 A135

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0017148 negative regulation of translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5tcu, PDBe:5tcu, PDBj:5tcu
• PDBsum: 5tcu
• PubMed: 28487427
• UniProt: Q2FW38|RL13_STAA8 Large ribosomal subunit protein uL13 (Gene Name=rplM)