Structure of PDB 7q7p Chain LLL

Receptor sequence

>7q7pLLL (length=273) Species: 1079 (Blastochloris viridis) [Search protein sequence]

ALLSFERKYRVRGGTLIGGDLFDFWVGPYFVGFFGVSAIFFIFLGVSLIG
YAASQGPTWDPFAISINPPDLKYGLGAAPLLEGGFWQAITVCALGAFISW
MLREVEISRKLGIGWHVPLAFCVPIFMFCVLQVFRPLLLGSWGHAFPYGI
LSHLDWVNNFGYQYLNWHYNPGHMSSVSFLFVNAMALGLHGGLILSVANP
GDGDKVKTAEHENQYFRDVVGYSIGALSIHRLGLFLASNIFLTGAFGTIA
SGPFWTRGWPEWWGWWLDIPFWS

3D structure

PDB

7q7p Lipidic cubic phase serial femtosecond crystallography structure of a photosynthetic reaction centre.

Chain

LLL

Resolution

2.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BCB	LLL	F97 M127 V157 N158 F160 W167 H168 H173 S176 V177 F181 F241 G244 T248	F97 M127 V157 N158 F160 W167 H168 H173 S176 V177 F181 F241 G244 T248
BS02	BCB	LLL	F128 F146 H153 L154 V157	F128 F146 H153 L154 V157
BS03	BPB	LLL	I42 W100 E104 A120 F121 P124 Y148 G149 H153 A237 F241	I42 W100 E104 A120 F121 P124 Y148 G149 H153 A237 F241
BS04	UQ1	LLL	H190 L193 E212 F216 S223 I224 G225 A226 I229	H190 L193 E212 F216 S223 I224 G225 A226 I229
BS05	UQ1	LLL	W263 W266	W263 W266
BS06	FE2	LLL	H190 H230	H190 H230
BS07	MQ7	LLL	W100 R103	W100 R103
BS08	BCB	LLL	M174 V177 S178 V182	M174 V177 S178 V182
BS09	BPB	LLL	F181 M185 L189	F181 M185 L189

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7q7p, PDBe:7q7p, PDBj:7q7p
PDBsum	7q7p
PubMed	35647917
UniProt	P06009\|RCEL_BLAVI Reaction center protein L chain (Gene Name=pufL)

[Back to BioLiP]