Structure of PDB 8y0u Chain LL

Receptor sequence

>8y0uLL (length=193) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

AISKNLPILKNHFRKHWQERVKVHFDQAGKKVSRRNARATRAAKIAPRPL
DLLRPVVRAPTVKYNRKVRAGRGFTLAEVKAAGLTAAYARTIGIAVDHRR
QNRNQEIFDANVQRLKEYQSKIIVFPRNGKAPEAEQVLSAAATFPIAQPA
TDVEARAVQDNGESAFRTLRLARSEKKFRGIREKRAREKAEAE

3D structure

PDB

8y0u dormant ribosome with STM1

Chain

Resolution

3.59 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LL	A2 K5 L7 L10 N12 H13 F14 R15 K16 H17 W18 Q19 Q28 K31 K32 R35 R36 R39 R42 R55 V58 R59 P61 T62 Y65 N66 K68 R70 G72 R73 R91 H99 R100 R104 R128 R171 R174 F179 R183 K185 R186	A1 K4 L6 L9 N11 H12 F13 R14 K15 H16 W17 Q18 Q27 K30 K31 R34 R35 R38 R41 R54 V57 R58 P60 T61 Y64 N65 K67 R69 G71 R72 R90 H98 R99 R103 R127 R170 R173 F178 R182 K184 R185

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8y0u, PDBe:8y0u, PDBj:8y0u
PDBsum	8y0u
PubMed	38698775
UniProt	Q12690\|RL13A_YEAST Large ribosomal subunit protein eL13A (Gene Name=RPL13A)

[Back to BioLiP]