Structure of PDB 8pv8 Chain LL

Receptor sequence

>8pv8LL (length=203) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

NNHFRKHWQRRVRCHFDQPGKKVTRRLARRAKAAALAPRPVDKLRPIVRC
PTVKYNRRTRLGRGFTLEELKAAGIPRLLAPTIGIAVDHRRKNLSEESLA
ANVQRLKDYKARLILFPRKSNKPKKADTPKDQQTAETTTSLRTSFGVEQP
LAPGFTEISKSEIPAGIEGGAYRALRKARSDARLVGVREKRAKEKAEAEA
NKK

3D structure

PDB

8pv8 Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.

Chain

Resolution

2.91 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LL	H13 F14 R15 K16 H17 W18 R23 Q28 P29 K31 K32 R35 R36 R39 K42 R55 V58 R59 P61 T62 Y65 N66 R68 R70 G72 R73 L77 K81 R87 D98 H99 R100 R101 K102 S105 R128 K129 S130 N131 K132 K134 K135 K140 R152 Y182 R183 R186 R189 D191 R193 L194 R198 R201	H3 F4 R5 K6 H7 W8 R13 Q18 P19 K21 K22 R25 R26 R29 K32 R45 V48 R49 P51 T52 Y55 N56 R58 R60 G62 R63 L67 K71 R77 D88 H89 R90 R91 K92 S95 R118 K119 S120 N121 K122 K124 K125 K130 R142 Y172 R173 R176 R179 D181 R183 L184 R188 R191
BS02	rna	LL	D27 T34	D17 T24

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8pv8, PDBe:8pv8, PDBj:8pv8
PDBsum	8pv8
PubMed	37921038
UniProt	G0S992

[Back to BioLiP]