Structure of PDB 7b7d Chain LL

Receptor sequence

>7b7dLL (length=218) Species: 559292 (Saccharomyces cerevisiae S288C)

ARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVH
LVSNELEQLSSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRINK
MLSCAGADRLQQGMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVEG
LRRARYKFPGQQKIILSKKWGFTNLDRPEYLKKREAGEVKDDGAFVKFLS
KKGSLENNIREFPEYFAA

3D structure

• PDB: 7b7d eEF3 promotes late stages of tRNA translocation including E-tRNA release from the ribosome
• Chain: LL
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LL	R3 R4 A6 R7 C8 K13 N14 K15 P16 Y17 R21 Y22 K30 Y34 D35 K39 K40 E63 A64 A67 K74 R88 R90 H92 F94 R98 A106 R110 Q112 M115 R116 A118 W119 Q133 Y157 K158 D193 G194 F196	R2 R3 A5 R6 C7 K12 N13 K14 P15 Y16 R20 Y21 K29 Y33 D34 K38 K39 E62 A63 A66 K73 R87 R89 H91 F93 R97 A105 R109 Q111 M114 R115 A117 W118 Q132 Y156 K157 D192 G193 F195
BS02	rna	LL	E56 L57 K202 K203 G204 S205 L206 N209 F217	E55 L56 K201 K202 G203 S204 L205 N208 F216

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0006415 translational termination

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7b7d, PDBe:7b7d, PDBj:7b7d
• PDBsum: 7b7d
• UniProt: P41805|RL10_YEAST Large ribosomal subunit protein uL16 (Gene Name=RPL10)