Structure of PDB 6woo Chain LL

Receptor sequence

>6wooLL (length=145) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

STELTVQSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTPKTAIEG
SYIDKKCPFTGLVSIRGKILTGTVVSTKMHRTIVIRRAYLHYIPKYNRYE
KRHKNVPVHVSPAFRVQVGDIVTVGQCRPISKTVRFNVVKVSAAT

3D structure

PDB

6woo An active role of the eukaryotic large ribosomal subunit in translation initiation fidelity.

Chain

Resolution

2.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LL	E10 A12 P17 H18 F20 W34 K36 N37 G39 L40 K43 K56 K57 L63 S65 I66 R67 G68 K69 S77 M80 H81 T83 Y90 H92 P95 K96 Y97 K102 R103 H104 K105 N106 Q127 R129 P130 I131 S132 K133 T134 R136 F137	E9 A11 P16 H17 F19 W33 K35 N36 G38 L39 K42 K55 K56 L62 S64 I65 R66 G67 K68 S76 M79 H80 T82 Y89 H91 P94 K95 Y96 K101 R102 H103 K104 N105 Q126 R128 P129 I130 S131 K132 T133 R135 F136

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0030686	90S preribosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6woo, PDBe:6woo, PDBj:6woo
PDBsum	6woo
PubMed
UniProt	P0CX47\|RS11A_YEAST Small ribosomal subunit protein uS17A (Gene Name=RPS11A)