Structure of PDB 6tcl Chain LL

Receptor sequence
>6tclLL (length=154) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418) [Search protein sequence]
NREVVFPAGRDPQWGNLETPVNASPLVKWFINNLPAYRPGLTPFRRGLEV
GMAHGYFLFGPFAKLGPLRDAANANLAGLLGAIGLVVLFTLALSLYANSN
PPTALASVTVPNPPDAFQSKEGWNNFASAFLIGGIGGAVVAYFLTSNLAL
IQGL
3D structure
PDB6tcl Distinct structural modulation of photosystem I and lipid environment stabilizes its tetrameric assembly.
ChainLL
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 AJP LL P41 L42 W45 P25 L26 W29
BS02 CLA LL V21 T35 V5 T19
BS03 CLA LL T35 V37 T19 V21
BS04 CLA LL P77 F78 L81 P61 F62 L65
BS05 CLA LL P83 L84 P67 L68
BS06 CLA LL R54 R61 E65 M68 R38 R45 E49 M52
BS07 CLA LL P51 A52 H70 F73 P35 A36 H54 F57
BS08 CLA LL Y72 F73 T161 Y56 F57 T145
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009538 photosystem I reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6tcl, PDBe:6tcl, PDBj:6tcl
PDBsum6tcl
PubMed32170279
UniProtP58577|PSAL_NOSS1 Photosystem I reaction center subunit XI (Gene Name=psaL)

[Back to BioLiP]