Structure of PDB 5lzu Chain LL

Receptor sequence

>5lzuLL (length=143) Species: 9986 (Oryctolagus cuniculus)

DIQTERAYQKQPTIFQNKKRVKLPRYYKNIGLGFKTPKEAIEGTYIDKKC
PFTGNVSIRGRILSGVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNMS
VHLSPCFRDVQIGDIVTVGECRPLSKTVRFNVLKVTKAAGTKK

3D structure

• PDB: 5lzu Decoding Mammalian Ribosome-mRNA States by Translational GTPase Complexes.
• Chain: LL
• Resolution: 3.75 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LL	E7 R8 A9 Q11 T15 F17 Y36 N39 I40 G41 L42 K48 K58 K59 G64 N65 S67 I68 R69 R71 K79 K81 M82 Q83 T85 V87 R89 R90 Y92 H94 R97 K98 K104 R105 H106 K107 N108 E130 R132 P133 S135 K136 T137 R139 F140 K152	E5 R6 A7 Q9 T13 F15 Y26 N29 I30 G31 L32 K38 K48 K49 G54 N55 S57 I58 R59 R61 K69 K71 M72 Q73 T75 V77 R79 R80 Y82 H84 R87 K88 K94 R95 H96 K97 N98 E120 R122 P123 S125 K126 T127 R129 F130 K142

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022626 cytosolic ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5lzu, PDBe:5lzu, PDBj:5lzu
• PDBsum: 5lzu
• PubMed: 27863242
• UniProt: G1TRM4|RS11_RABIT Small ribosomal subunit protein uS17 (Gene Name=RPS11)