Structure of PDB 8rxh Chain LK

Receptor sequence

>8rxhLK (length=169) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]

KSHYICAGRLVRILRGPRQDRVGVIVDIVDANRVLVENPEDAKMWRHVQN
LKNVEPLKYCVSVSRNCSAKALKDALASSKALEKYAKTRTAARVEAKKAC
AVSTDFERYQLRVARRSRAHWARKVFDEKDAKTPVSWHKVALKKMLKKAA
KMDSTEGAKRRMQKAIAAR

3D structure

PDB

8rxh Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.

Chain

Resolution

2.93 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	LK	R17 G18 P19 R20 N34 K45 W47 H49 V50 N55 N68	R15 G16 P17 R18 N32 K43 W45 H47 V48 N53 N66
BS02	rna	LK	K146 M154 D155 R163 M164 A167 I168 R171	K144 M152 D153 R161 M162 A165 I166 R169
BS03	rna	LK	Y6 C8 R11 T90 R91 T92 R95 V96 K99 R114 V115 R118 S119 H122 W123 R125 W139	Y4 C6 R9 T88 R89 T90 R93 V94 K97 R112 V113 R116 S117 H120 W121 R123 W137

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0042273	ribosomal large subunit biogenesis

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8rxh, PDBe:8rxh, PDBj:8rxh
PDBsum	8rxh
PubMed	38722744
UniProt	Q4QBJ1

[Back to BioLiP]