Structure of PDB 8p8n Chain LK

Receptor sequence

>8p8nLK (length=220) Species: 4932 (Saccharomyces cerevisiae)

QVAAERAARKAANKEKRAIILERNAAYQKEYETAERNIIQAKRDAKAAGS
YYVEAQHKLVFVVRIKGINKIPPKPRKVLQLLRLTRINSGTFVKVTKATL
ELLKLIEPYVAYGYPSYSTIRQLVYKRGFGKINKQRVPLSDNAIIEANLG
KYGILSIDDLIHEIITVGPHFKQANNFLWPFKLSNPSGGWGVPRKFKHFI
QGGSFGNREEFINKLVKSMN

3D structure

• PDB: 8p8n Real-space refinement in PHENIX for cryo-EM and crystallography.
• Chain: LK
• Resolution: 2.15 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LK	R33 K34 N37 R41 R60 R67 K70 K90 G91 I92 N93 K94 P97 K98 K101 L105 R107 R110 I111 A122 E125 L126 S142 R145 R151 Q159 R160 K196 N200 K206 L207 S208 N209 P210 S211 W214 R218 K219 K241	R9 K10 N13 R17 R36 R43 K46 K66 G67 I68 N69 K70 P73 K74 K77 L81 R83 R86 I87 A98 E101 L102 S118 R121 R127 Q135 R136 K172 N176 K182 L183 S184 N185 P186 S187 W190 R194 K195 K217
BS02	rna	LK	K128 R218 K221 H222 Q225	K104 R194 K197 H198 Q201

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0000470 maturation of LSU-rRNA
• GO:0002181 cytoplasmic translation
• GO:0042273 ribosomal large subunit biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8p8n, PDBe:8p8n, PDBj:8p8n
• PDBsum: 8p8n
• UniProt: P05737|RL7A_YEAST Large ribosomal subunit protein uL30A (Gene Name=RPL7A)