Structure of PDB 8k82 Chain LK

Receptor sequence

>8k82LK (length=158) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

NEVKYLYLRAVGGEVGASAALAPKIGPLGLSPKKVGEDIAKATKEFKGIK
VTVQLKIQNRQAAASVVPSASSLVITALKEPPRDRKKDKNVKHSGNIQLD
EIIEIARQMRDKSFGRTLASVTKEILGTAQSVGCRVDFKNPHDIIEGINA
GEIEIPEN

3D structure

PDB

8k82 Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LK	Y14 R16 A17 G19 F53 I56 K57 V58 T59 V60 V74 P75 S76 A77 S78 S79 V81 I82 D118 K119 S120 F121 G122 R123 T124 S127 V128 K130 E131 I132 G134 T135 Q137 S138 V139 H149 N156	Y7 R9 A10 G12 F46 I49 K50 V51 T52 V53 V67 P68 S69 A70 S71 S72 V74 I75 D111 K112 S113 F114 G115 R116 T117 S120 V121 K123 E124 I125 G127 T128 Q130 S131 V132 H142 N149

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0070180	large ribosomal subunit rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8k82, PDBe:8k82, PDBj:8k82
PDBsum	8k82
PubMed	38942792
UniProt	P0CX53\|RL12A_YEAST Large ribosomal subunit protein uL11A (Gene Name=RPL12A)

[Back to BioLiP]