Structure of PDB 8fkx Chain LK

Receptor sequence
>8fkxLK (length=108) Species: 9606 (Homo sapiens) [Search protein sequence]
PSRLRKTRKLRGHVSHGMKHYHLKRNQSFCPTVNLDKLWTLVSEQTRVNA
AKNKTGAAPIIDVVRSGYYKVLGKGKLPKQPVIVKAKFFSRRAEEKIKSV
GGACVLVA
3D structure
PDB8fkx Principles of human pre-60 S biogenesis.
ChainLK
Resolution2.59 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna LK P2 S3 R4 L5 R6 K7 T8 R9 K10 R12 G13 V15 S16 H17 K59 H60 Y61 P1 S2 R3 L4 R5 K6 T7 R8 K9 R11 G12 V14 S15 H16 K19 H20 Y21
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0016020 membrane
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8fkx, PDBe:8fkx, PDBj:8fkx
PDBsum8fkx
PubMed37410842
UniProtP46776|RL27A_HUMAN Large ribosomal subunit protein uL15 (Gene Name=RPL27A)

[Back to BioLiP]