Structure of PDB 8bsj Chain LK

Receptor sequence

>8bsjLK (length=197) Species: 5741 (Giardia intestinalis) [Search protein sequence]

GRRPARCYRYQKNKPYPKSRFCRGVPDPKIRYFDLGNRRAKVNDFPYCFH
LLSGEKEQVSSEALEACRIACNKYIAKKAGKDSFHLRIRVHPFHVIRINK
MLTGMRGAWGKPQGTVARVSIGQPLLSVRCRASAKDYVKDALRRAKFKIP
GRQAIVESRNWGFTEFTKEEYEDLRERGELQYDGNNAHRISRKGPLN

3D structure

PDB

8bsj Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis.

Chain

Resolution

6.49 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	LK	Y11 E56 K57 R202 K203 G204 L206	Y10 E55 K56 R192 K193 G194 L196
BS02	rna	LK	R4 P5 R7 C8 K13 N14 K15 P16 Y17 P18 F22 F34 D35 R39 R40 E63 A64 K74 R88 R90 H92 F94 R98 I99 M102 M115 R116 A118 W119 G120 Q133 R154 K156 F157 K158 D193 G194 N195 N196 H198	R3 P4 R6 C7 K12 N13 K14 P15 Y16 P17 F21 F33 D34 R38 R39 E62 A63 K73 R87 R89 H91 F93 R97 I98 M101 M105 R106 A108 W109 G110 Q123 R144 K146 F147 K148 D183 G184 N185 N186 H188
BS03	rna	LK	Y33 R39 R69 I70 K74	Y32 R38 R68 I69 K73

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8bsj, PDBe:8bsj, PDBj:8bsj
PDBsum	8bsj
PubMed	36912103
UniProt	A8BM86

[Back to BioLiP]