Structure of PDB 8rxx Chain LJ

Receptor sequence

>8rxxLJ (length=135) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]

QANVKGCRFRVSVALPVGAVVNCADNTGAKNLYVISVKGYHGRLNRLPSA
ALGDMVMCSVKKGKPELRKKVLNAVIIRQRKSWRRKDGTVIYFEDNAGVI
VNPKGEMKGSGIAGPVAKESADLWPKISTHAPAIV

3D structure

PDB

8rxx Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.

Chain

Resolution

2.97 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LJ	A18 P20 G22 A23 V24 Y37 I39 S40 K42 G43 Y44 H45 G46 R47 L48 N49 R50 L51 M61 S63 K73 V75 R84 K85	A14 P16 G18 A19 V20 Y33 I35 S36 K38 G39 Y40 H41 G42 R43 L44 N45 R46 L47 M57 S59 K69 V71 R80 K81
BS02	rna	LJ	G10 C11 R12 F13 R14 S16 R47 R50 K85 R88 V94	G6 C7 R8 F9 R10 S12 R43 R46 K81 R84 V90

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0070180	large ribosomal subunit rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links