Structure of PDB 8pv7 Chain LJ

Receptor sequence

>8pv7LJ (length=169) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

KAQNPMRELRIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYT
VRQFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRRRNFSETGNFG
FGISEHIDLGIKYDPSIGIYGMDFYCCMTRPGERVAKRRRCKSRIGASHR
ITREETIRWFKQRFDGIVR

3D structure

PDB

8pv7 Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.

Chain

Resolution

2.12 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LJ	K17 V19 N21 S23 S49 A51 R52 F58 A67 H69 R95 N96 S98 E99 T100 N102 G104 F105 G106 I107 G125 D127 Y129 R143 R148	K13 V15 N17 S19 S45 A47 R48 F54 A63 H65 R91 N92 S94 E95 T96 N98 G100 F101 G102 I103 G121 D123 Y125 R139 R144
BS02	rna	LJ	K5 N8 M10 R11 Q44 T45 V47 T71 R73 G136 R138 V139 R142 R144 S147 G150 H153	K1 N4 M6 R7 Q40 T41 V43 T67 R69 G132 R134 V135 R138 R140 S143 G146 H149

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8pv7, PDBe:8pv7, PDBj:8pv7
PDBsum	8pv7
PubMed	37921038
UniProt	G0SHQ2

[Back to BioLiP]