Structure of PDB 8k82 Chain LJ

Receptor sequence

>8k82LJ (length=169) Species: 4932 (Saccharomyces cerevisiae)

QNPMRDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQTPVQSKARYTVR
TFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYQLRDRNFSATGNFGFG
IDEHIDLGIKYDPSIGIFGMDFYVVMNRPGARVTRRKRCKGTVGNSHKTT
KEDTVSWFKQKYDADVLDK

3D structure

• PDB: 8k82 Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
• Chain: LJ
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LJ	T53 R55	T48 R50
BS02	rna	LJ	K16 N20 S22 S48 A50 R51 Y52 F57 I59 R94 N95 S97 A98 N101 G103 F104 G105 D107 G124 D126 Y128 K142	K11 N15 S17 S43 A45 R46 Y47 F52 I54 R89 N90 S92 A93 N96 G98 F99 G100 D102 G119 D121 Y123 K137
BS03	rna	LJ	M9 Q43 T44 V46 T70 R72 G135 R137 V138 R141 R143 G149 N150 H152	M4 Q38 T39 V41 T65 R67 G130 R132 V133 R136 R138 G144 N145 H147

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8k82, PDBe:8k82, PDBj:8k82
• PDBsum: 8k82
• PubMed: 38942792
• UniProt: P0C0W9|RL11A_YEAST Large ribosomal subunit protein uL5A (Gene Name=RPL11A)