Structure of PDB 8bsi Chain LJ

Receptor sequence

>8bsiLJ (length=181) Species: 5741 (Giardia intestinalis) [Search protein sequence]

LCSSMTIKVPTDVECTINKRVVTVKGKKGTLVRDFSHAPLDITHANDTIS
VAVWFPRGKRNALPRTICSHIENMFKGVTYGFEYKMRLAYAHFPIAATVV
DNNKAIEIRNFMHQIKTRRIECLPGVTIAMSTNVKDELILRGISIEDVSH
TAARIHESLKVPNKDLRKFLDGCYVSSRGLQ

3D structure

PDB

8bsi Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis.

Chain

Resolution

3.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LJ	K21 R22 H39 L42 D43 W56 R59 G60 K61 N63 A64 R67 T68 S71 H72 N75 Y86 H94 F95 M114 H115 Q116 I117 K118 E148 S151 H152 R156 P164 K166 D167 R169 K170 F171 R180	K19 R20 H37 L40 D41 W54 R57 G58 K59 N61 A62 R65 T66 S69 H70 N73 Y84 H92 F93 M112 H113 Q114 I115 K116 E146 S149 H150 R154 P162 K164 D165 R167 K168 F169 R178

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8bsi, PDBe:8bsi, PDBj:8bsi
PDBsum	8bsi
PubMed	36912103
UniProt	A8BNT5

[Back to BioLiP]