Structure of PDB 8bip Chain LJ

Receptor sequence

>8bipLJ (length=169) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

QNPMRDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQTPVQSKARYTVR
TFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYQLRDRNFSATGNFGFG
IDEHIDLGIKYDPSIGIFGMDFYVVMNRPGARVTRRKRCKGTVGNSHKTT
KEDTVSWFKQKYDADVLDK

3D structure

PDB

8bip The dynamic architecture of Map1- and NatB-ribosome complexes coordinates the sequential modifications of nascent polypeptide chains.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LJ	P8 M9 Q43 T44 T70 R72 G135 R137 R140 R141 R143 G149 N150 H152	P3 M4 Q38 T39 T65 R67 G130 R132 R135 R136 R138 G144 N145 H147
BS02	rna	LJ	K16 V18 N20 S22 G24 S48 A50 R51 F57 I65 H68 R94 N95 S97 A98 T99 G103 F104 G105 D107 G124 M125 Y128	K11 V13 N15 S17 G19 S43 A45 R46 F52 I60 H63 R89 N90 S92 A93 T94 G98 F99 G100 D102 G119 M120 Y123

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8bip, PDBe:8bip, PDBj:8bip
PDBsum	8bip
PubMed	37079644
UniProt	Q3E757\|RL11B_YEAST Large ribosomal subunit protein uL5B (Gene Name=RPL11B)

[Back to BioLiP]