Structure of PDB 6z6j Chain LJ

Receptor sequence

>6z6jLJ (length=169) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

QNPMRDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQTPVQSKARYTVR
TFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYQLRDRNFSATGNFGFG
IDEHIDLGIKYDPSIGIFGMDFYVVMNRPGARVTRRKRCKGTVGNSHKTT
KEDTVSWFKQKYDADVLDK

3D structure

PDB

6z6j Structure and function of yeast Lso2 and human CCDC124 bound to hibernating ribosomes.

Chain

Resolution

3.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LJ	K16 N20 S22 S48 A50 R51 Y52 F57 I59 N95 S97 A98 T99 N101 F104 D107 G124 D126 Y128 R140 K142	K11 N15 S17 S43 A45 R46 Y47 F52 I54 N90 S92 A93 T94 N96 F99 D102 G119 D121 Y123 R135 K137
BS02	rna	LJ	M9 Q43 T44 V46 H68 T70 R72 G135 R137 V138 R141 R143 V148 G149 N150 H152	M4 Q38 T39 V41 H63 T65 R67 G130 R132 V133 R136 R138 V143 G144 N145 H147

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6z6j, PDBe:6z6j, PDBj:6z6j
PDBsum	6z6j
PubMed	32687489
UniProt	P0C0W9\|RL11A_YEAST Large ribosomal subunit protein uL5A (Gene Name=RPL11A)

[Back to BioLiP]