Structure of PDB 8xt3 Chain LI

Receptor sequence
>8xt3LI (length=95) Species: 9606 (Homo sapiens) [Search protein sequence]
TVIVERWWKVPLAGEGRKPRLHRRHRVYKLVEDTKHRPKENLELILTQSV
ENVGVRGDLVSVKKSLGRNRLLPQGLAVYASPENKKLFEEEKLLR
3D structure
PDB8xt3 Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
ChainLI
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna LI W60 P63 L64 A65 G66 E67 R69 R72 H74 R75 R76 R78 K87 H88 K91 S117 N121 R122 W8 P11 L12 A13 G14 E15 R17 R20 H22 R23 R24 R26 K35 H36 K39 S65 N69 R70
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8xt3, PDBe:8xt3, PDBj:8xt3
PDBsum8xt3
PubMed38942792
UniProtQ9BYD2|RM09_HUMAN Large ribosomal subunit protein bL9m (Gene Name=MRPL9)

[Back to BioLiP]