Structure of PDB 8rxx Chain LI

Receptor sequence

>8rxxLI (length=208) Species: 347515 (Leishmania major strain Friedlin)

PKGNNAIPHVHQKKHWNPCSSQKGNVKVFLNQPAQKHRRRRLRLLKAKKV
FPRPLKALRPQVNCPTVRHNMKRRLGRGFSPAELKAAGLNPQYAATIGIR
VDSRRKNKSEEGMNVNVQRLKTYMSKLVLFPMNHKKVQKGEASEEEVKAA
TQDRSRFGDAAVGAVVYPSAEAPRAVSAEEKSMCVYAFLKKNHSAVRFFG
TRSSRAAR

3D structure

• PDB: 8rxx Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
• Chain: LI
• Resolution: 2.97 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LI	P2 G4 N6 P9 V11 H12 Q13 K14 K15 H16 S21 S22 Q23 K24 G25 N26 V27 Q33 P34 K37 R40 R41 R44 L45 K47 R54 V63 N64 C65 P66 T67 R69 H70 N71 M72 R74 R75 G77 R78 P82 N91 P92 Q93 T97 R101 V102 D103 S104 R105 R106 K107 S110 N134 H135 E145 R155 R157 Y168 Y187 K191 H194 R198	P1 G3 N5 P8 V10 H11 Q12 K13 K14 H15 S20 S21 Q22 K23 G24 N25 V26 Q32 P33 K36 R39 R40 R43 L44 K46 R53 V62 N63 C64 P65 T66 R68 H69 N70 M71 R73 R74 G76 R77 P81 N90 P91 Q92 T96 R100 V101 D102 S103 R104 R105 K106 S109 N133 H134 E144 R154 R156 Y167 Y186 K190 H193 R197
BS02	rna	LI	K191 K192 S195 F199 G201 R203 R206	K190 K191 S194 F198 G200 R202 R205
BS03	rna	LI	N32 A35 Q36 R39 R42	N31 A34 Q35 R38 R41

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005730 nucleolus
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8rxx, PDBe:8rxx, PDBj:8rxx
• PDBsum: 8rxx
• PubMed: 38722744
• UniProt: E9AEA8