Structure of PDB 8p8n Chain LI

Receptor sequence

>8p8nLI (length=286) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

KSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVVRFTN
KDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGLLIAR
RTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRTTTGA
RVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFGGHVSQY
MEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADPAFKPTE
KKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAAL

3D structure

PDB

8p8n Real-space refinement in PHENIX for cryo-EM and crystallography.

Chain

Resolution

2.15 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LI	K8 R15 F16 Q17 P19 R23 T28 Y31 R35 L36 K43 Y44 T46 K48 P139 R140 F142 F145 I148 L150 R152 T153 P174 H175 S176 N178 R179	K1 R8 F9 Q10 P12 R16 T21 Y24 R28 L29 K36 Y37 T39 K41 P132 R133 F135 F138 I141 L143 R145 T146 P167 H168 S169 N171 R172
BS02	rna	LI	S10 S13 S14 F16 T18 F20 R21 R22 T28 Y30 R33 R50 R54 T56 N57 K58 Q63 I65 I69 D72 V74 Y79 G91 N94 W95 Q151 R152 T154 T155 A157 R158 Y198 H203 Y207 R218 E221 K224 F253 T256 K258 F260 Q264 Y265 A266 E268 S269 K270 Y272 R273 Q274 K276 L277 R285 V286	S3 S6 S7 F9 T11 F13 R14 R15 T21 Y23 R26 R43 R47 T49 N50 K51 Q56 I58 I62 D65 V67 Y72 G84 N87 W88 Q144 R145 T147 T148 A150 R151 Y191 H196 Y200 R211 E214 K217 F246 T249 K251 F253 Q257 Y258 A259 E261 S262 K263 Y265 R266 Q267 K269 L270 R278 V279

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8p8n, PDBe:8p8n, PDBj:8p8n
PDBsum	8p8n
PubMed
UniProt	P26321\|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]