Structure of PDB 8bsi Chain LI

Receptor sequence

>8bsiLI (length=180) Species: 5741 (Giardia intestinalis) [Search protein sequence]

TPFVRWPRQVRIQRQKAVLQRRLKVPPTVNQFMNPISRNLTNEIFNLARK
YSPESKEEHKARLLQISDKLVIASGIRRITSLVESKRAKLVLIANDVDPL
ELVLWLPTLCHKMGVPYAIVRTKGDLGKLVHLKKTTSVCFTDVNPEDKPT
FDKILAAVAHEVDYAKAMKTYGGGVRREDE

3D structure

PDB

8bsi Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis.

Chain

Resolution

3.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LI	Q37 V38 Q41 R42 R66 N136 D137 R162 T163	Q9 V10 Q13 R14 R38 N95 D96 R121 T122
BS02	rna	LI	F31 R33 P35 R36 Q37 R50 L51 H87 G116 I117 R118 R119 V138 P140 L143 K164 G165 K169 L173 K174 K175 T176 T177 R218	F3 R5 P7 R8 Q9 R22 L23 H59 G75 I76 R77 R78 V97 P99 L102 K123 G124 K128 L132 K133 K134 T135 T136 R177

Gene Ontology

	Molecular Function
GO:0003723	RNA binding

	Biological Process
GO:0000470	maturation of LSU-rRNA

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8bsi, PDBe:8bsi, PDBj:8bsi
PDBsum	8bsi
PubMed	36912103
UniProt	A8BLL7

[Back to BioLiP]