Structure of PDB 8bip Chain LI

Receptor sequence

>8bipLI (length=218) Species: 4932 (Saccharomyces cerevisiae)

ARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVH
LVSNELEQLSSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRINK
MLSCAGADRLQQGMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVEG
LRRARYKFPGQQKIILSKKWGFTNLDRPEYLKKREAGEVKDDGAFVKFLS
KKGSLENNIREFPEYFAA

3D structure

• PDB: 8bip The dynamic architecture of Map1- and NatB-ribosome complexes coordinates the sequential modifications of nascent polypeptide chains.
• Chain: LI
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LI	Y11 L57 K202 K203 G204 L206	Y10 L56 K201 K202 G203 L205
BS02	rna	LI	R3 R4 A6 R7 C8 K13 N14 K15 Y22 R24 K30 Y34 D35 K39 K40 S61 E63 A64 A67 K74 R90 H92 F94 R98 D109 R110 Q112 M115 R116 A118 W119 G120 Y157 K158 G194 A195 F196 K198	R2 R3 A5 R6 C7 K12 N13 K14 Y21 R23 K29 Y33 D34 K38 K39 S60 E62 A63 A66 K73 R89 H91 F93 R97 D108 R109 Q111 M114 R115 A117 W118 G119 Y156 K157 G193 A194 F195 K197

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0006415 translational termination

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8bip, PDBe:8bip, PDBj:8bip
• PDBsum: 8bip
• PubMed: 37079644
• UniProt: P41805|RL10_YEAST Large ribosomal subunit protein uL16 (Gene Name=RPL10)