Structure of PDB 7zjw Chain LI

Receptor sequence

>7zjwLI (length=226) Species: 9986 (Oryctolagus cuniculus)

RNFAELKIKRLRKKFAQKMLRKARRKLIYEKAKHYHKEYRQMYRTEIRMA
RMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTF
VKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDN
TLIARSLGKYNIICMEDLIHEIYTVGKHFKEANNFLWPFKLSSPRGGMKK
KTTHFVEGGDAGNREDQINRLIRRMN

3D structure

• PDB: 7zjw Structure of the mammalian ribosome as it decodes the selenocysteine UGA codon.
• Chain: LI
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LI	R22 F24 K28 K30 R31 R33 F36 R42 R45 R46 K47 Y50 H57 K58 Y60 R61 Y64 R65 I68 R69 M70 R72 M73 R75 A77 R95 G96 I97 N98 G99 P102 K106 L110 R112 Q115 I116 K123 K126 A127 N130 I134 L146 N150 K155 K164 R165 T172 A175 R176 G179 K180 I184 E187 K201 N205 K211 L212 S213 S214 P215 R216 G217 G218 M219 K221 K222 R241 R244	R1 F3 K7 K9 R10 R12 F15 R21 R24 R25 K26 Y29 H36 K37 Y39 R40 Y43 R44 I47 R48 M49 R51 M52 R54 A56 R74 G75 I76 N77 G78 P81 K85 L89 R91 Q94 I95 K102 K105 A106 N109 I113 L125 N129 K134 K143 R144 T151 A154 R155 G158 K159 I163 E166 K180 N184 K190 L191 S192 S193 P194 R195 G196 G197 M198 K200 K201 R220 R223
BS02	rna	LI	R133 K221 T223 T224 H225	R112 K200 T202 T203 H204

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit

External links

• PDB: RCSB:7zjw, PDBe:7zjw, PDBj:7zjw
• PDBsum: 7zjw
• PubMed: 35709277
• UniProt: A0A7J8C453