Structure of PDB 7xnx Chain LI

Receptor sequence

>7xnxLI (length=202) Species: 9606 (Homo sapiens) [Search protein sequence]

GRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGH
MVSDEYEQLSSEALEAARICANKYMVKSCGKDGFHIRVRLHPFHVIRINK
MGMRGAFGKPQGTVARVHIGQVIMSIRTKLQNKEHVIEALRRAKFKFPGR
QKIHISKKWGFTKFNADEFEDMVAEKRLIPDGCGVKYIPSRGPLDKWRAL
HS

3D structure

PDB

7xnx A Dynamic rRNA Ribomethylome Drives Stemness in Acute Myeloid Leukemia.

Chain

Resolution

2.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LI	R4 A6 R7 C8 K13 K15 Y17 R21 F22 D35 K39 K40 S61 E63 A64 A67 K74 R90 H92 F94 R98 N100 M102 G114 M115 R116 G117 A118 F119 Q133 F157 K158 P160 R162 D193 C195 K198	R3 A5 R6 C7 K12 K14 Y16 R20 F21 D34 K38 K39 S60 E62 A63 A66 K73 R89 H91 F93 R97 N99 M101 G102 M103 R104 G105 A106 F107 Q121 F145 K146 P148 R150 D181 C183 K186
BS02	rna	LI	Y11 E56 Y57 I131 Y199 S202 R203 G204 L206	Y10 E55 Y56 I119 Y187 S190 R191 G192 L194

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005783	endoplasmic reticulum
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7xnx, PDBe:7xnx, PDBj:7xnx
PDBsum	7xnx
PubMed	36259929
UniProt	X5D2T3

[Back to BioLiP]