Structure of PDB 7qvp Chain LI

Receptor sequence

>7qvpLI (length=206) Species: 9606 (Homo sapiens)

GRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLGGH
MVSDEYEQLSSEALEAARICANKYMVKSCGRDGFHMRVRLHPFHVIRINK
MLLQTGMRGAFGKPQGTVARVHIGQVIMSIRTKLQNEEHVIEALRRAKFK
FPGRQKIHISKKWGFTKFNADEFEDMVAKKCLIPDGCGVKYVPSHGPLDK
WRVLHS

3D structure

• PDB: 7qvp A distinct mammalian disome collision interface harbors K63-linked polyubiquitination of uS10 to trigger hRQT-mediated subunit dissociation.
• Chain: LI
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LI	R3 R4 R7 C8 K13 N14 K15 P16 Y17 F22 R24 K30 I33 F34 D35 K39 S61 E63 A64 A67 K74 R88 R90 H92 R98 N100 M102 M115 R116 G117 A118 F119 G120 Q133 R154 F157 K158 P160 K198	R2 R3 R6 C7 K12 N13 K14 P15 Y16 F21 R23 K29 I32 F33 D34 K38 S60 E62 A63 A66 K73 R87 R89 H91 R97 N99 M101 M107 R108 G109 A110 F111 G112 Q125 R146 F149 K150 P152 K190
BS02	rna	LI	Y11 E56 Y57 I131 Y199 S202 H203 G204 L206 W209	Y10 E55 Y56 I123 Y191 S194 H195 G196 L198 W201

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0006412 translation
• GO:0007141 male meiosis I
• GO:0007283 spermatogenesis
• GO:0030154 cell differentiation
• GO:0051321 meiotic cell cycle

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005783 endoplasmic reticulum
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0016020 membrane
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7qvp, PDBe:7qvp, PDBj:7qvp
• PDBsum: 7qvp
• PubMed: 36302773
• UniProt: Q96L21|RL10L_HUMAN Ribosomal protein uL16-like (Gene Name=RPL10L)