Structure of PDB 7cpv Chain LI

Receptor sequence

>7cpvLI (length=201) Species: 10090 (Mus musculus)

GRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGH
MVSDEYEQLSSEALEAARICANKYMVKSCGKDGFHIRVRLHPFHVIRINK
GMRGAFGKPQGTVARVHIGQVIMSIRTKLQNKEHVIEALRRAKFKFPGRQ
KIHISKKWGFTKFNADEFEDKVAAKRLIPDGCGVKYIPERGPLDKWRALH
S

3D structure

• PDB: 7cpv A male germ-cell-specific ribosome controls male fertility.
• Chain: LI
• Resolution: 3.03 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LI	R3 R4 R7 C8 K13 N14 K15 P16 F22 R24 K30 D35 K39 K40 S61 E63 A64 A67 R90 H92 F94 R98 I99 N100 G114 M115 R116 G117 A118 F119 G120 R154 F157 K158 P160 R162 D193 G194 K198	R2 R3 R6 C7 K12 N13 K14 P15 F21 R23 K29 D34 K38 K39 S60 E62 A63 A66 R89 H91 F93 R97 I98 N99 G101 M102 R103 G104 A105 F106 G107 R141 F144 K145 P147 R149 D180 G181 K185
BS02	rna	LI	Y11 E56 Y57 I131 Y199 E202 R203 G204 L206 W209	Y10 E55 Y56 I118 Y186 E189 R190 G191 L193 W196

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0006412 translation
• GO:0007141 male meiosis I
• GO:0007283 spermatogenesis
• GO:0030154 cell differentiation
• GO:0051321 meiotic cell cycle

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005783 endoplasmic reticulum
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7cpv, PDBe:7cpv, PDBj:7cpv
• PDBsum: 7cpv
• PubMed: 36517592
• UniProt: P86048|RL10L_MOUSE Large ribosomal subunit protein uL16-like (Gene Name=Rpl10l)