Structure of PDB 6z6j Chain LI

Receptor sequence

>6z6jLI (length=209) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

ARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVH
LVSNELEQLSSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRINK
QGMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVEGLRRARYKFPGQ
QKIILSKKWGFTNLDRPEYLKKREAGEVKDDGAFVKFLSKKGSLENNIRE
FPEYFAAQA

3D structure

PDB

6z6j Structure and function of yeast Lso2 and human CCDC124 bound to hibernating ribosomes.

Chain

Resolution

3.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LI	R4 R7 C8 K13 K15 Y22 Y34 D35 K39 K40 E63 A64 R90 H92 F94 R98 Q113 G114 M115 R116 G117 A118 W119 G120 Q133 R154 Y157 K158 P160 D193 G194 K198	R3 R6 C7 K12 K14 Y21 Y33 D34 K38 K39 E62 A63 R89 H91 F93 R97 Q101 G102 M103 R104 G105 A106 W107 G108 Q121 R142 Y145 K146 P148 D181 G182 K186
BS02	rna	LI	Y11 E56 K202 K203 G204 L206 N209	Y10 E55 K190 K191 G192 L194 N197

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0006415	translational termination

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6z6j, PDBe:6z6j, PDBj:6z6j
PDBsum	6z6j
PubMed	32687489
UniProt	P41805\|RL10_YEAST Large ribosomal subunit protein uL16 (Gene Name=RPL10)

[Back to BioLiP]