Structure of PDB 6y2l Chain LI

Receptor sequence

>6y2lLI (length=206) Species: 9606 (Homo sapiens)

GRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLGGH
MVSDEYEQLSSEALEAARICANKYMVKSCGRDGFHMRVRLHPFHVIRINK
MLLQTGMRGAFGKPQGTVARVHIGQVIMSIRTKLQNEEHVIEALRRAKFK
FPGRQKIHISKKWGFTKFNADEFEDMVAKKCLIPDGCGVKYVPSHGPLDK
WRVLHS

3D structure

• PDB: 6y2l Dynamics of uS19 C-Terminal Tail during the Translation Elongation Cycle in Human Ribosomes.
• Chain: LI
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LI	R3 R4 P5 A6 R7 K13 N14 K15 Y17 F22 D35 K39 S61 E63 A67 K74 R88 R90 H92 F94 R98 N100 Q112 M115 R116 G117 A118 F119 G120 Q133 F157 K158 P160 G194 K198	R2 R3 P4 A5 R6 K12 N13 K14 Y16 F21 D34 K38 S60 E62 A66 K73 R87 R89 H91 F93 R97 N99 Q104 M107 R108 G109 A110 F111 G112 Q125 F149 K150 P152 G186 K190
BS02	rna	LI	Y11 E56 Y57 Y199 H203 G204 L206 W209	Y10 E55 Y56 Y191 H195 G196 L198 W201

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0006412 translation
• GO:0007141 male meiosis I
• GO:0007283 spermatogenesis
• GO:0030154 cell differentiation
• GO:0051321 meiotic cell cycle

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005783 endoplasmic reticulum
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0016020 membrane
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6y2l, PDBe:6y2l, PDBj:6y2l
• PDBsum: 6y2l
• PubMed: 32268098
• UniProt: Q96L21|RL10L_HUMAN Ribosomal protein uL16-like (Gene Name=RPL10L)