Structure of PDB 6t7t Chain LI

Receptor sequence

>6t7tLI (length=218) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

ARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVH
LVSNELEQLSSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRINK
MLSCAGADRLQQGMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVEG
LRRARYKFPGQQKIILSKKWGFTNLDRPEYLKKREAGEVKDDGAFVKFLS
KKGSLENNIREFPEYFAA

3D structure

PDB

6t7t Molecular mechanism of translational stalling by inhibitory codon combinations and poly(A) tracts.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LI	Y11 E56 K202 G204 L206	Y10 E55 K201 G203 L205
BS02	rna	LI	R3 R4 R7 C8 N14 K15 Y22 R24 K30 K40 E63 A64 A67 R90 H92 F94 R98 G107 D109 R110 Q113 M115 R116 G117 A118 W119 Q133 Y157 K158 P160 D193 G194 A195 K198	R2 R3 R6 C7 N13 K14 Y21 R23 K29 K39 E62 A63 A66 R89 H91 F93 R97 G106 D108 R109 Q112 M114 R115 G116 A117 W118 Q132 Y156 K157 P159 D192 G193 A194 K197

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0006415	translational termination

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6t7t, PDBe:6t7t, PDBj:6t7t
PDBsum	6t7t
PubMed	31858614
UniProt	P41805\|RL10_YEAST Large ribosomal subunit protein uL16 (Gene Name=RPL10)

[Back to BioLiP]