Structure of PDB 6zu5 Chain LH0

Receptor sequence

>6zu5LH0 (length=184) Species: 235221 (Paranosema locustae)

MKRLLCEEKVEIPEGCSVEILERVMTVRGKRATAVRDLSHFVLTMDVHEG
HVRLRLWNGTNRERSKLITCASVIRNCIVGCMSGYEYTLKVVYKHFPMSV
AIEDDGKTVVVKNFLGQKHARRYKMRGDSIARLGTEKDTFVVEGSSLEDV
SQSAGTIQENCQVKKIDSRTFLDGIYFLSRNVVG

3D structure

• PDB: 6zu5 Differences in structure and hibernation mechanism highlight diversification of the microsporidian ribosome.
• Chain: LH0
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LH0	H40 R62 S65 K66 I68 T69 Y87 K94 H95 F96 G116 Q117 K118 H119 R126 S151 Q152 E159 D167 R169 T170 F171	H40 R62 S65 K66 I68 T69 Y87 K94 H95 F96 G116 Q117 K118 H119 R126 S151 Q152 E159 D167 R169 T170 F171
BS02	AMP	LH0	R23 V42 L43 T44 L56 W57	R23 V42 L43 T44 L56 W57

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Jan 19 04:56:03 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6zu5', asym_id = 'LH0', title = 'Differences in structure and hibernation mechani...t diversification of the microsporidian ribosome.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6zu5', asym_id='LH0', title='Differences in structure and hibernation mechani...t diversification of the microsporidian ribosome.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412,0019843', uniprot = '', pdbid = '6zu5', asym_id = 'LH0'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0019843', uniprot='', pdbid='6zu5', asym_id='LH0')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>