Structure of PDB 8rxx Chain LH

Receptor sequence

>8rxxLH (length=221) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]

AFPSRKDAFRAQRKGAKKHRPEIIVIDLKDHVLGRAAAVVAKQLLLGKKI
TVVRCEQLNIAGTEIRNKIKYLQYLRKRKLTNPTKGPFHHRAPSDVFVRT
VRSMLPRYTKRGMKALNSLVAYEGIPPNVVRTGGRVVIPRAQRHVCYRSE
RPYTVLGNMCKHVGWKYSDVVANLEKARVEKASRHHEKQAKLRDAWKSAR
KEALAKMPKHNVEVLKKFGYA

3D structure

PDB

8rxx Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.

Chain

Resolution

2.97 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	LH	V33 G35 R36 A39 K43 L46 I66 R67 I70 K71 L73 Q74 R77 K78 R79 K80 L81 T101 S104 M105 K111 R112 R141 H145 V146 Y148 R149 R152	V32 G34 R35 A38 K42 L45 I65 R66 I69 K70 L72 Q73 R76 K77 R78 K79 L80 T100 S103 M104 K110 R111 R140 H144 V145 Y147 R148 R151
BS02	rna	LH	R11 H20 P22 I24 K50 I51 K80 N83 K86 P88 F89 R108 Y109 S119 V121 Y123 E124 P128 N129 R132 K182 R185 H186 K189	R10 H19 P21 I23 K49 I50 K79 N82 K85 P87 F88 R107 Y108 S118 V120 Y122 E123 P127 N128 R131 K181 R184 H185 K188
BS03	rna	LH	A2 F3 P4 R6 K7 F10 Q13 K69 R79 P84 T85 H90 H91 R92 H163 G165 K167 Y168	A1 F2 P3 R5 K6 F9 Q12 K68 R78 P83 T84 H89 H90 R91 H162 G164 K166 Y167
BS04	rna	LH	R11 R14 K15 K30 R55 V131 R132 G134 G135 R136 R179 A183 H187 W197 R201 H211 N212 G220 Y221	R10 R13 K14 K29 R54 V130 R131 G133 G134 R135 R178 A182 H186 W196 R200 H210 N211 G219 Y220

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0017148	negative regulation of translation

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8rxx, PDBe:8rxx, PDBj:8rxx
PDBsum	8rxx
PubMed	38722744
UniProt	Q4QFG2

[Back to BioLiP]