Structure of PDB 8pv7 Chain LH

Receptor sequence

>8pv7LH (length=190) Species: 759272 (Thermochaetoides thermophila DSM 1495)

MRYIHSEETIPVPENVKVSIKSRLVTVEGPRGKLQKDLSHIAVNFSVVKK
GVIGLEIHHGSRKDVAALRTVRTIINNMIIGVTKGFKYKMRYVYAHFPIN
VNVEKNAETGCYEVEIRNFIGEKIVRKVVMAPGVEVEISKAQKDELILSG
NSLEAVSQSAADIQQICKVRNKDIRKFLDGIYVSEKGNIV

3D structure

• PDB: 8pv7 Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.
• Chain: LH
• Resolution: 2.12 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LH	M1 S59 R60 H77 V80 N81 I94 H95 R99 A103 R106 T107 T110 I111 F134 E159 K160 I161 S194 Q195 A198 Q202 R207 K209 D210 R212 K213 F214	M1 S22 R23 H40 V43 N44 I57 H58 R62 A66 R69 T70 T73 I74 F97 E122 K123 I124 S157 Q158 A161 Q165 R170 K172 D173 R175 K176 F177

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Dec 2 22:28:45 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8pv7', asym_id = 'LH', title = 'Structural insights into coordinating 5S RNP rot...TS2 pre-RNA processing during ribosome formation.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8pv7', asym_id='LH', title='Structural insights into coordinating 5S RNP rot...TS2 pre-RNA processing during ribosome formation.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412,0019843', uniprot = '', pdbid = '8pv7', asym_id = 'LH'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0019843', uniprot='', pdbid='8pv7', asym_id='LH')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>