Structure of PDB 8p8n Chain LH

Receptor sequence

>8p8nLH (length=360) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

RPQVTVHSLTGEATANALPLPAVFSAPIRPDIVHTVFTSVNKNKRQAYAV
SEKAGHQTSAESWGTGRAVARIPRVGGGGTGRSGQGAFGNMCRGGRMFAP
TKTWRKWNVKVNHNEKRYATASAIAATAVASLVLARGHRVEKIPEIPLVV
STDLESIQKTKEAVAALKAVGAHSDLLKVLKSKKLRAGKGKYRNRRWTQR
RGPLVVYAEDNGIVKALRNVPGVETANVASLNLLQLAPGAHLGRFVIWTE
AAFTKLDQVWGSETVASSKVGYTLPSHIISTSDVTRIINSSEIQSAIRPA
GQATQKRTHVLKKNPLKNKQVLLRLNPYAKVFAAEKLGSKKAEKTGTKPA
AVFTETLKHD

3D structure

PDB

8p8n Real-space refinement in PHENIX for cryo-EM and crystallography.

Chain

Resolution

2.15 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	LH	R31 H36 T40 K44 N45 K46 R47 Q48 Y50 V52 S53 E54 A56 H58 Q59 S61 T67 G68 A70 V71 R73 P75 G80 G81 T82 Q87 N92 M93 R95 G96 R98 M99 F100 A101 K104 W106 R107 K108 K112 N114 H115 N116 E117 K118 R119 R138 G139 R141 K161 T162 K163 K180 S184 K186 L187 R188 A189 G190 K191 K193 Y194 R195 R197 R202 R203 Y209 K217 R220 N221 P223 T227 S232 N234 P240 G241 H243 K271 V272 I290 R300 A302 G303 Q304 A305 Q307 K308 R309 T310 V312 L313 K315 N320 Q322 L324 R326 A331 K332 F334 A335 S341 K342 K343 A344 T347 T349 P351 L359	R29 H34 T38 K42 N43 K44 R45 Q46 Y48 V50 S51 E52 A54 H56 Q57 S59 T65 G66 A68 V69 R71 P73 G78 G79 T80 Q85 N90 M91 R93 G94 R96 M97 F98 A99 K102 W104 R105 K106 K110 N112 H113 N114 E115 K116 R117 R136 G137 R139 K159 T160 K161 K178 S182 K184 L185 R186 A187 G188 K189 K191 Y192 R193 R195 R200 R201 Y207 K215 R218 N219 P221 T225 S230 N232 P238 G239 H241 K269 V270 I288 R298 A300 G301 Q302 A303 Q305 K306 R307 T308 V310 L311 K313 N318 Q320 L322 R324 A329 K330 F332 A333 S339 K340 K341 A342 T345 T347 P349 L357
BS02	rna	LH	A49 A51 K193	A47 A49 K191
BS03	MG	LH	N114 H115 N116	N112 H113 N114

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8p8n, PDBe:8p8n, PDBj:8p8n
PDBsum	8p8n
PubMed
UniProt	P10664\|RL4A_YEAST Large ribosomal subunit protein uL4A (Gene Name=RPL4A)

[Back to BioLiP]