Structure of PDB 8k82 Chain LH

Receptor sequence

>8k82LH (length=190) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

MKYIQTEQQIEVPEGVTVSIKSRIVKVVGPRGTLTKNLKHIDVTFTKVNN
QLIKVAVHNGGRKHVAALRTVKSLVDNMITGVTKGYKYKMRYVYAHFPIN
VNIVEKDGAKFIEVRNFLGDKKIRNVPVRDGVTIEFSTNVKDEIVLSGNS
VEDVSQNAADLQQICRVRNKDIRKFLDGIYVSHKGFITED

3D structure

PDB

8k82 Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LH	M1 S19 I20 K21 R23 I24 K26 H40 D42 V43 T44 V57 H58 R62 A66 R69 T70 S73 N77 H96 F97 K121 K122 S155 Q156 A159 Q163 K170 D171 R173 K174 F175	M1 S19 I20 K21 R23 I24 K26 H40 D42 V43 T44 V57 H58 R62 A66 R69 T70 S73 N77 H96 F97 K121 K122 S155 Q156 A159 Q163 K170 D171 R173 K174 F175

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8k82, PDBe:8k82, PDBj:8k82
PDBsum	8k82
PubMed	38942792
UniProt	P05738\|RL9A_YEAST Large ribosomal subunit protein uL6A (Gene Name=RPL9A)

[Back to BioLiP]